PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_11528_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 772aa    MW: 86294.2 Da    PI: 8.104
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_11528_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP116.11.9e-3673150178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqv gCead+se+k yh+rh+vC  +++a++vl++g+++r+CqqC++fh ls+fDe+krsCrr+L++hn+rrr+k+ 
  Neem_11528_f_1  73 RCQVSGCEADISELKGYHKRHRVCLRCANASAVLLDGESKRYCQQCGKFHILSDFDEGKRSCRRKLERHNNRRRRKSV 150
                     6*************************************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.1E-2770135IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.62471148IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.1E-3372151IPR004333Transcription factor, SBP-box
PfamPF031102.5E-2774148IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 772 aa     Download sequence    Send to blast
MNPNKHRKAT NRCHDFPTLA KISIIIGLTC SNFLAGRIPC ACPEIDEKLE EEEAGLPGKK  60
RARTVRAGVG QARCQVSGCE ADISELKGYH KRHRVCLRCA NASAVLLDGE SKRYCQQCGK  120
FHILSDFDEG KRSCRRKLER HNNRRRRKSV DSKGAVDNEP PGASHSEDIV CDDDAGKDSL  180
CLSSQITDQE TFLEAEDGHV TGLNSAPNAQ NVNSDSGISF AASGEIRIDG GKDNSKTSPS  240
PSYCDNKSSY SSMCPTGRIS FKLYDWNPAE FPRRLRHQIF QWLASMPVEL EGYIRPGCTI  300
LTIFVAMPKI MWMKLYADPI RYVHDFVIAP GRMLSGRGPM FVHLNNMIFH VKDGTSVMKV  360
NVEVQAPRLH YVHPTCFEAG KPMEFVACGS NLLQSKFRFL ISFAGKYLPY VYRIASPHGE  420
TDGDPLTFDH QLYKIRVPHT EPNLFGPAFI EVENESGLSN FIPVLIGDKE TCSEMKIIQQ  480
RFEASLITKR SQLMAGDSLS NLCGISALRQ KTFTELLVDI AWLLKVPASE SFLYFMSSSR  540
VQRFNCLFSF LINNESTVIL EKLLQNLKIL MDSMEFNSAI NGINDADLGL LFKYMDNARE  600
ILQRKLQKDG GLMQHAVNIV QERICGSQSS FQSNLLVPST SQVRASILSY RGSNKMILDH  660
DLDTRSNTKL GVMVYSAAVD RCETTPLLNK EVIMNVNLIK EWPRKSCGHI LSGTVLSSRP  720
AIFVIVMAAV CFGVCVVVLH PQKIKYEAEV TWCTCKVVVH LDPDGRATWD IA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A2e-4272154486squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134146RRKLERHNNRRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006419724.10.0hypothetical protein CICLE_v10004348mg
SwissprotQ8S9G80.0SPL7_ARATH; Squamosa promoter-binding-like protein 7
TrEMBLV4U1340.0V4U134_9R
STRINGVIT_05s0020g02160.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63582644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.10.0squamosa promoter binding protein-like 7